PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00052202-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 774aa    MW: 87069.3 Da    PI: 5.7571
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00052202-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.66.5e-1154007711374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lL++cA+av+++d++ a+++L++++++asp+gd +qRla yf+ AL arl++s+ +l+++ ++  ts    +e l+a++l+  + P+ k 
  PSME_00052202-RA 400 LRALLVHCAQAVATDDTRGANEILKQIRQHASPYGDGTQRLANYFADALVARLSGSGGRLFSTPSSVLTS---AAEILKAYQLLLFAIPTAKS 489
                       5789*********************************************************999999988...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s++++Nq++l+ +++++r+Hi+Df+i +G+QWp+L+q+LasRp+gpp+lRiTg++ p++g   +e++eetg+rLa++A+++gvpfe+++ +a 
  PSME_00052202-RA 490 SYFLTNQTVLNVTDKSNRLHIVDFGILYGFQWPSLIQSLASRPGGPPMLRITGIDFPQPGfrAAERIEETGRRLADYAKSFGVPFEYHA-IAA 581
                       ***********************************************************9*9***************************.799 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e++++eeL+++++E+l+Vn++++  +llde+v les+++ vL+ ++s++P+v+++   +   n++ F +rf e l yysalfd++e+ +pr
  PSME_00052202-RA 582 KWENVDVEELSLRSDEVLVVNCMYRFNNLLDETVVLESPKNIVLNKIRSMNPRVFIHGVVNGAFNAPFFITRFREVLFYYSALFDAIETIVPR 674
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       e+ +r  +E+el+gr i nvvaceg er+ r et+++W+ r+++aGF ++pl+  + +q +   + +  + +rv+e+ ++++ gWk+r   +v
  PSME_00052202-RA 675 EHPQRLLLEKELFGRVILNVVACEGLERVVRPETYKQWQVRIQRAGFVQLPLDRAIFSQTRDNFKSFFHKDFRVDEDGKWILYGWKGRITSAV 767
                       *******************************************************************9888********************** PP

              GRAS 371 SaWr 374
                         Wr
  PSME_00052202-RA 768 ATWR 771
                       ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.782374751IPR005202Transcription factor GRAS
PfamPF035142.3E-112400771IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 774 aa     Download sequence    Send to blast
MADEKTGIFH SNNINVVSNN IRLQRPWLQQ GTAMPATQFR GFQPPMPDEK TGIFYSDNIN  60
GVSNNIWLQR PRLQQETAMP ATQFRGSLSS EKSITISDGE SEDTEVYSDI VLKYISDMLM  120
DENMDEKKCM YQECSALQAT VKPFYDILGE NYPPQGLCNS NTVGENQKQS LNYYEDDVQN  180
KIEDSSWIGD FFNSQMPGGF ESPLSPNLFA GYSSQYLFNY SGSSAVTDSL PGSPTYEPSL  240
SESKQGLEDI QVVPKQNFEP GVENGCHFRA PKKVSEPDPD LQLGKREDAI FGVGVTFQMN  300
AAHSEDENGP KREKDPHRGD LDLEDRDSNK LSAVYPDNVI RNESFDKVLL CTENGRVFLA  360
VQLEILQNGV LKSVQSGFLK GLQGSKARGR KQGKRAVVDL RALLVHCAQA VATDDTRGAN  420
EILKQIRQHA SPYGDGTQRL ANYFADALVA RLSGSGGRLF STPSSVLTSA AEILKAYQLL  480
LFAIPTAKSS YFLTNQTVLN VTDKSNRLHI VDFGILYGFQ WPSLIQSLAS RPGGPPMLRI  540
TGIDFPQPGF RAAERIEETG RRLADYAKSF GVPFEYHAIA AKWENVDVEE LSLRSDEVLV  600
VNCMYRFNNL LDETVVLESP KNIVLNKIRS MNPRVFIHGV VNGAFNAPFF ITRFREVLFY  660
YSALFDAIET IVPREHPQRL LLEKELFGRV ILNVVACEGL ERVVRPETYK QWQVRIQRAG  720
FVQLPLDRAI FSQTRDNFKS FFHKDFRVDE DGKWILYGWK GRITSAVATW RPST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-514047718375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937597.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010937596.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA3E2G20.0A3E2G2_PINRA; SCARECROW-like protein 1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-177GRAS family protein